If you had the ability to do gene editing with ONE gene for the betterment of human kind, which one would you choose, and why? Assume you could either change an abnormal allele associated with a disease, such as the cystin gene associated with Cystic Fibrosis to its normal wild type, or add a pre-existing human allele to a genome

If you had the ability to do gene editing with ONE gene for the betterment of human kind, which one would you choose, and why? Assume you could either change an abnormal allele associated with a disease, such as the cystin gene associated with Cystic Fibrosis to its normal wild type, or add a pre-existing human allele to a genome

Concepts of Biology

1st Edition

ISBN:9781938168116

Author:Samantha Fowler, Rebecca Roush, James Wise

Publisher:Samantha Fowler, Rebecca Roush, James Wise

Chapter10: Biotechnology

Section: Chapter Questions

Problem 12CTQ: Describe two of the applications for genome mapping.

See similar textbooks

Similar questions

a) Explain the difference between a genome and a transcriptome. Do all cells in an organism have the same genomes and or transcriptomes? b) Explain a method you could use to compare transcriptomes, and what you can learn from comparing transcriptomes.
What is a fluorophore? If you wanted to fluorescently label a brain cell, describe one way you could genetically label a brain cell using a transgenic approach and give one way you could genetically label a brain cell using a gene targeting homologous recombination approach.
7) The Human Genome project cost billions of dollars to complete. What was it and do you think it was worth the cost? Use at least two lines of reasoning to support your opinion.
I sequence the DNA of 3 people and see variation in my gene of interest as follows: Person 1: ATGCAACAATTTAATAAT Person 2: ATGCAACGACGACGACGACAATTTAATAAT Person 3: ATGCAACGACGACGACGACGACGACGACGACAATTTAATAAT What is the name for this kind of variation?
Do all of them True/False 31) The process by which an electrical charge is used to introduce DNA into a cell to produce a transgenic organism is called electroporation.Answer: 32) Reproductive cloning is used to produce large amounts of mammalian proteins from transgenic agricultural animals such as cattle.Answer: 33) In gene addition, homologous recombination is used to remove the original gene and replace it with the cloned gene.Answer: 34) All stem cells have the potential to differentiateAnswer: 35) A bone marrow transplant involves the transfer of multipotent stem cellsAnswer: 36) The fact that in mammalian systems multiple genes may compensate for the loss of a gene is called gene redundancy.Answer:
Describe two of the applications for genome mapping.
1. a) If you were at risk of a fatal disease such as Huntington’s disease and only the 95% accurate preliminary genetic test was available, would you take the test? After all, 95% of the time the test would tell you whether you would eventually get Huntington’s disease or whether you did not have to worry about getting this disease. b) The linkage distance between the DNA sequence used in the test and the actual Huntington’ disease locus was 5%. In a large sample of the Venezuelan family, what percentage of people would inherit the DNA sequence but not the Huntington’s allele (i.e. be a false positive test for Huntington’s)? What percentage of that large Venezuelan family would not inherit the DNA sequence but would inherit the Huntington’s allele (i.e., be a false negative test for Huntington’s)?
The first attempts at gene therapy began in 1990 with the treatment of a young girl with a genetic disorder abbreviated SCID. What does SCID stand for? In the context of SCID, what does ADA stand for?
1) What do you want to learn, if anything, about your own genome? Answer: Honestly i am not a biological son of my parents therefore i am an adopted child, so what comes in my mind of knowing my own genome is to know about Genetic and biochemical disorder of my real parents or ancestors if there is any. Is my answer correct? if not, please make it correct
Ronan Farrow, son of the actress Mia Farrow, has grown up thinking that Woody Allen is his father. But Vanity Fair broke the story that Frank Sinatra might be Ronan's actual father. Vanity Fair would like to confirm the story but they are almost bankrupt. So they hire you. You're also almost bankrupt and can't afford to pay for full genome sequencing. You should be able to solve the case by sequencing a short stretch of DNA from one chromosome from Ronan and comparing it to a sequence from the same chromosome in Woody Allen. Which chromosome would you choose for your sequencing project v Choose... X-Chromosome It turns out that Woody Allen will not cooperate with this project. Ba Any autosomal chromosome nce Y-Chromosome information from which living individual, if any, can you use to solve the Relatives of Woody Allen Relatives of Frank Sinatra Woody Allen Mia Farrow Mia Farrow Frank Sinatra 4 4 6 II 1 ? II ? 2 Ronan might be Woody's son Ronan might be Frank's son 3. 2.
a) Bioinformatics is an interdisciplinary field that integrates computer science with mathematics and statistics to solve biological questions. Many bioinformatics tools for gene prediction, homology modelling and such are available free online. (i) How can online tools such as BLAST and FASTA assist in our genomics research? Is the sequence below in FASTA format? Justify your answer. >gi 129295|sp|P01013 | OVAX_CHICK GENE X PROTEIN (OVALBUMIN-RELATED) QIKDLLVSSSTDLDTTLVLVNAIYFKGMWKTAFNAEDTREMPFHVTKQESKPVQMMCMNNSFNVATLPAE KMKILELPFASGDLSMLVLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEEKYNLTS VLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGVIEDIKHSPESEQFRADHP (ii) FLFLIKHNPTNTIVYFGRYWSP
Give the scope of the following fields in Applied Genetics: Epigenetics Genomics Genetic Engineering Phylogenetics Metagenics take note that SCOPE is what I'm asking