Biochemistry: Concepts and Connections (2nd Edition)
2nd Edition
ISBN: 9780134641621
Author: Dean R. Appling, Spencer J. Anthony-Cahill, Christopher K. Mathews
Publisher: PEARSON
expand_more
expand_more
format_list_bulleted
Concept explainers
Videos
Textbook Question
Chapter 10, Problem 4P
The lipid portion of a typical bilayers is about
a. Calculate the minimum number of residues in an
b. Calculate the minimum number of residues in an
c. Explain why
d. The epidermal growth factor receptor has a single transmembrane helix. Find it in this partial sequence:
...RGPKIPSIATGMVGALLLLVVALGIGILFMRRRH…
Expert Solution & Answer
Learn your wayIncludes step-by-step video
schedule08:04
Students have asked these similar questions
Researchers have discovered a new membrane protein that has three transmembrane domain αhelixes that span the lipid bilayer.a. If the lipid bilayer is 30 Å thick, what is the smallest number of amino acid residues thatcan be in each α-helixes for them to be long enough to span the bilayer?
Explain how both alpha helices and beta sheets can be used by proteins that cross membranes.
Also explain what a hydropathy plot is and how such a plot can be used to differentiate transmembrane alpha helices from transmembrane beta sheets.
why do transmembrane proteins cross the phospholipid bilayer as an a-helix or B-barrel?
A. These structures arrange polar peptide bonds and hydrogen bonds to the exterior of the helix or barrel while nonpolar side chains are on the interior.
B. These structures sequester polar peptide bonds and hydrogen bonds to the interior of the helix or barrel
while nonpolar sidechains are on the exterior.
Chapter 10 Solutions
Biochemistry: Concepts and Connections (2nd Edition)
Ch. 10 - Prob. 1PCh. 10 - Given these molecular components--glycerol, fatty...Ch. 10 - The classic demonstration that cell plasma...Ch. 10 - The lipid portion of a typical bilayers is about...Ch. 10 - In the following situations, what is the free...Ch. 10 - Propose an experiment that would distinguish...Ch. 10 - Prob. 7PCh. 10 - Peptide hormones (such as insulin) must bind to...Ch. 10 - Prob. 9PCh. 10 - Prob. 10P
Ch. 10 - Prob. 11PCh. 10 - Prob. 12PCh. 10 - Prob. 13PCh. 10 - Prob. 14PCh. 10 - The concentration of glucose in your circulatory...Ch. 10 - ATP is synthesized from ADP, Pi , and a proton on...Ch. 10 - The Na+/ glucose symport transports glucose from...Ch. 10 - Prob. 18PCh. 10 - Prob. 19PCh. 10 - The transport of aspirin (pKa = 3.5, structure...Ch. 10 - Prob. 21P
Additional Science Textbook Solutions
Find more solutions based on key concepts
Three bulbs, two of which contain different gases and one of which is empty, are connected as shown in the foll...
Fundamentals of General, Organic, and Biological Chemistry (8th Edition)
An aluminum calorimeter with a mass of 100 g contains 250 g of water. The calorimeter and water are in thermal ...
Physics for Scientists and Engineers, Technology Update (No access codes included)
Predict whether a precipitation reaction will occur when aqueous solutions of the following substances are mixe...
CHEMISTRY-TEXT
45. ** A piece of wire, shown in Figure P20.45 , moves downward perpendicular to a magnetic field. (a) In what ...
College Physics
4. Three groups of nonvascular plants are _______, ______, and _______. Three groups of seedless vascular plant...
Biology: Life on Earth (11th Edition)
Knowledge Booster
Learn more about
Need a deep-dive on the concept behind this application? Look no further. Learn more about this topic, biochemistry and related others by exploring similar questions and additional content below.Similar questions
- What can you infer about the structure and cellular localization of the protein below based on its hydropathy index? 40 -20 -40 20 40 60 80 100 120 140 160 180 200 220 240 Residue number A. It is a cytosolic protein B. It is a lysosomal enzyme that works in the lumen of the lysosome. O C. It is a cytosolic protein with a single-pass transmembrane domain O D. It is a multi-pass transmembrane protein that will be ultimately found on the cell surface but may also be found In the ER, Golgi, or lysosomal membranes. Hydropathic indexarrow_forwardSome alpha helices might be amphipathic. Where exactly in the protein structure would you find this type of helices. Explain how the position of amino acids in the sequence defines the structure of such helices. a. b.arrow_forwardThe lipid portion of a typical bilayer is about 30 Å thick.(a) Calculate the minimum number of residues in an a-helix required tospan this distance.(b) Calculate the minimum number of residues in a b-strand required tospan this distance.(c) Explain why a-helices are most commonly observed in transmembraneprotein sequences when the distance from one side of a membrane to theother can be spanned by significantly fewer amino acids in a b-strandconformation.(d) The epidermal growth factor receptor has a single transmembrane helix.Find it in this partial sequence: . . . RGPKIPSIATGMVGALLLLVVALGIGILFMRRRH . . .arrow_forward
- B) We also know from studies of protein structure that one turn of an a-helix includes 3.6 amino acid residues and extends the long axis of the helix by - 0.56 nm. Approximately how many amino acids must a helical transmembrane segment of an integral membrane protein have if the segment is to span the lipid bilayer defined by two stearate molecules laid end to end, plus the polar head groups to which the stearate molecules are attached (assume a polar head group has a diameter of 0.5 nm)?arrow_forwardMake a table with a scale of absorbance and the concentration of protein in Chromatin sample from the following data for excel graph Absorbance=660nm following data are of tubes with concern A =0 B=0.036 C=0.011 D=0.001 E=0.027 F=0.020 G=0.032 H1=0.176 H2=0.183 I1=0.150 I2=0.171 also plot the graph??arrow_forwardAn unspecified protein contains a 15-residue long α-helix with the following sequence: WEANIKQRLSTMGEYKQCHANG a. How many full turns are there in this α-helix? b. What is the length of the helix (in Angstroms) in the direction of the helix axis? c. How many hydrogen bonding interactions would be there in this α-helix? d. If it was a 310 helix instead with a helical pitch of 6 Å, is it long enough to span the 30 Å bilayer? Calculate and explain.arrow_forward
- Create a figure that includes a schematic of the topological map of AlaE. In your topological map, label; a. the cytoplasm, periplasm and membrane, b. the start and end of each predicted transmembrane helix with the residue letter and number found there, c. the N- and C-termini. The amino acid sequence is 149 in length: MFSPQSRLRHAVADTFAMVVYCSVVNMCIEVFLSGMSFEQSFYSRLVAIPVNILIAWPYGMYRDLFMRAARKVSPSGWIKNLADILAYVTFQSPVYVAILLVVGADWHQIMAAVSSNIVVSMLMGAVYGYFLDYCRRLFKVSRYQQVKAarrow_forwardSDS-PAGE gels are used to study changes in protein primary structure. Which of the following statements about SDS-PAGE gels is correct? A. The negatively charged proteins will move towards the negatively charged electrode in the SDS-Page chamber B. A detergent is needed to disrupt protein secondary, tertiary, and quaternary structure before a gel can be run C. No "stains" or other treatments are needed to "see" the protein bands on a gel D. Long polypeptides move a further distance from the loading well in a SDS-PAGE gel than short polypeptidesarrow_forwardAlpha-helices have 3.6 amino acid residues per turn, ie a helix 36 amino acids long would form 10 turns, and The axial distance between adjacent residues is 3.5 Angstroms. Beta-helices have two residues per repeat unit which gives the beta-strand a 7 Angstrom pitch. This compares with the alpha-helix where the axial distance between adjacent residues is only 1.5 Angstroms. Then how many residues in an alpha-helix conformation would it take to traverse the same distance as 10 residues in beta-strand conformation?arrow_forward
- Monomeric, single-pass transmembrane proteins span a membrane with a single a helix that has characteristic chemical properties in the region of the bilayer. Which of the three 20-amino-acid sequences listed below is the most likely candidate for such a transmembrane segment? O TLIYFGVMAGVIGTILLIS O ITPIYFGPMAGVIGTPLLIS ITEIYFGRMAGVIGTDLLISarrow_forwardThe major reason that antiparallel beta-stranded protein structures are more stable than parallel beta-stranded structures is that: Select one: a. parallel ones are in a slightly less extended configuration than antiparallel strands. b. parallel ones do not have as many disulfide crosslinks between adjacent strands. c. parallel ones do not stack in sheets as well as antiparallel strands. X d. parallel ones have fewer hydrogen bonds than antiparallel strands. e. parallel ones have weaker hydrogen bonds between adjacent strands.arrow_forwardI'm honestly confused on where to start with this question. I think it has something to do with the residues per turn but can you please explain and show detailed work on the the problem. Researchers have discovered a new membrane protein that has three transmembrane domain αhelixes that span the lipid bilayer. a. If the lipid bilayer is 30 Å thick, what is the smallest number of amino acid residues that can be in each α-helixes for them to be long enough to span the bilayer? b. If one of the three α-helixes is titled at a 32° angle relative to an axis perpendicular to the surface of the lipid bilayer, what is the smaller number of amino acid helixes required for that helix to still span the lipid bilayer? c. How many hydrogen bonding interactions would there be in the smallest possible tilted transmembrane α-helix? d. If the tilted α-helix was a 310 helix instead how many amino acid residues would be required to span the lipid bilayer? How many amino acid residues would be required if…arrow_forward
arrow_back_ios
SEE MORE QUESTIONS
arrow_forward_ios
Recommended textbooks for you
BiochemistryBiochemistryISBN:9781319114671Author:Lubert Stryer, Jeremy M. Berg, John L. Tymoczko, Gregory J. Gatto Jr.Publisher:W. H. Freeman
Lehninger Principles of BiochemistryBiochemistryISBN:9781464126116Author:David L. Nelson, Michael M. CoxPublisher:W. H. Freeman
Fundamentals of Biochemistry: Life at the Molecul...BiochemistryISBN:9781118918401Author:Donald Voet, Judith G. Voet, Charlotte W. PrattPublisher:WILEY
BiochemistryBiochemistryISBN:9781305961135Author:Mary K. Campbell, Shawn O. Farrell, Owen M. McDougalPublisher:Cengage Learning
BiochemistryBiochemistryISBN:9781305577206Author:Reginald H. Garrett, Charles M. GrishamPublisher:Cengage Learning
Fundamentals of General, Organic, and Biological ...BiochemistryISBN:9780134015187Author:John E. McMurry, David S. Ballantine, Carl A. Hoeger, Virginia E. PetersonPublisher:PEARSON
Biochemistry
Biochemistry
ISBN:9781319114671
Author:Lubert Stryer, Jeremy M. Berg, John L. Tymoczko, Gregory J. Gatto Jr.
Publisher:W. H. Freeman
Lehninger Principles of Biochemistry
Biochemistry
ISBN:9781464126116
Author:David L. Nelson, Michael M. Cox
Publisher:W. H. Freeman
Fundamentals of Biochemistry: Life at the Molecul...
Biochemistry
ISBN:9781118918401
Author:Donald Voet, Judith G. Voet, Charlotte W. Pratt
Publisher:WILEY
Biochemistry
Biochemistry
ISBN:9781305961135
Author:Mary K. Campbell, Shawn O. Farrell, Owen M. McDougal
Publisher:Cengage Learning
Biochemistry
Biochemistry
ISBN:9781305577206
Author:Reginald H. Garrett, Charles M. Grisham
Publisher:Cengage Learning
Fundamentals of General, Organic, and Biological ...
Biochemistry
ISBN:9780134015187
Author:John E. McMurry, David S. Ballantine, Carl A. Hoeger, Virginia E. Peterson
Publisher:PEARSON
The Cell Membrane; Author: The Organic Chemistry Tutor;https://www.youtube.com/watch?v=AsffT7XIXbA;License: Standard youtube license